SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A138ZXU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A138ZXU6
Domain Number 1 Region: 124-214
Classification Level Classification E-value
Superfamily BAG domain 0.0000000000249
Family BAG domain 0.006
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000134
Family Ubiquitin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A138ZXU6
Sequence length 223
Comment (tr|A0A138ZXU6|A0A138ZXU6_GONPR) Uncharacterized protein {ECO:0000313|EMBL:KXS09289.1} KW=Complete proteome; Reference proteome OX=1344416 OS=Gonapodya prolifera JEL478. GN=M427DRAFT_491174 OC=Monoblepharidales; Gonapodyaceae; Gonapodya.
Sequence
MLSITLKYNNGQYPITIPRDATLADLKEEAENTLGFKPARVLYSGVAMKDDNCTLAKYGI
RSKASLLVLPPASAPEPPRPTPQRPERQSFASPRPSPVPRNGASPVADEGLSPEEAATVG
WLGDIVEGATKAVEPLLTTIRSNPPCDPSNPPPNPSRHPVTTTHLRLQETVMQALFKIDG
REIKDGWEKARERRRDAVRTLQATLKTADDLYERVMGIKPSLV
Download sequence
Identical sequences A0A138ZXU6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]