SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139ALW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139ALW7
Domain Number 1 Region: 20-59
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000209
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A139ALW7
Sequence length 59
Comment (tr|A0A139ALW7|A0A139ALW7_GONPR) Uncharacterized protein {ECO:0000313|EMBL:KXS17761.1} KW=Complete proteome; Reference proteome OX=1344416 OS=Gonapodya prolifera JEL478. GN=M427DRAFT_87701 OC=Monoblepharidales; Gonapodyaceae; Gonapodya.
Sequence
FDGDIEKLSEYTHNKSIVIAETEHYLDEHPELKHIISDYLQFLLYKKPEDVWSFTRDYF
Download sequence
Identical sequences A0A139ALW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]