SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139GK15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139GK15
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily XisI-like 2.09e-40
Family XisI-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A139GK15
Sequence length 111
Comment (tr|A0A139GK15|A0A139GK15_MICAE) FdxN element excision controlling factor protein {ECO:0000313|EMBL:KXS90537.1} KW=Complete proteome OX=449441 OS=Microcystis aeruginosa NIES-88. GN=OA58_14340 OC=Microcystaceae; Microcystis.
Sequence
MDSLEKMRKIIIESLRYYANLRYATGEVNRLLIIDKDSDNYLILLEGWDNRERVHGCLLH
LQIINGKIWIQRDGTEDGIATDLLAAGIPKEQIVLAFKPEHIRPYTEFAVK
Download sequence
Identical sequences A0A139GK15 A0A1E4Q975 A0A2H6L2V4 I4FF50 I4GLX7 I4HFP1 L7E2R0 S3J1Q8
WP_002736025.1.13945 WP_002736025.1.15998 WP_002736025.1.42333 WP_002736025.1.52201 WP_002736025.1.5315 WP_002736025.1.86711 WP_002736025.1.92877 WP_002736025.1.98808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]