SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139GP27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139GP27
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily XisI-like 1.03e-47
Family XisI-like 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A139GP27
Sequence length 111
Comment (tr|A0A139GP27|A0A139GP27_MICAE) Fatty-acid oxidation protein subunit alpha {ECO:0000313|EMBL:KXS91964.1} KW=Complete proteome OX=449441 OS=Microcystis aeruginosa NIES-88. GN=OA58_09180 OC=Microcystaceae; Microcystis.
Sequence
MEKLAQYRHYVKQVITEYSQIGSSKDPIEQQLIFDTVGDHYQLMYVGWKNRRRYHGCVLH
LDIKKGKIWIQHDGTEVGIANELVNLGVPKEDIVLAFHEPLVREYTGFAVG
Download sequence
Identical sequences A0A0K1S6A6 A0A139GP27 I4I1I4
WP_002798710.1.43975 WP_002798710.1.50331 WP_002798710.1.52201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]