SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139HN49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139HN49
Domain Number 1 Region: 12-114
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.18e-22
Family Steroid-binding domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A139HN49
Sequence length 124
Comment (tr|A0A139HN49|A0A139HN49_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KXT03914.1} KW=Complete proteome; Reference proteome OX=321146 OS=Mycosphaerella eumusae. GN=AC578_9326 OC=Mycosphaerella.
Sequence
MPGFEPKTPVNLDPPKDDIISLDYLSKCDGTHEGYPTYVAIKGTVFDVTGNKAYGPEGSY
KVFAGKDASRALAQSSLKAEEARPEWYDLSDEHKKVLNDWYTFFSKRYNIKGKVEGATNT
GEGQ
Download sequence
Identical sequences A0A139HN49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]