SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139IKN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139IKN0
Domain Number 1 Region: 326-448
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-29
Family cAMP-binding domain 0.00039
Further Details:      
 
Domain Number 2 Region: 187-324
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.81e-28
Family cAMP-binding domain 0.0000474
Further Details:      
 
Domain Number 3 Region: 5-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000863
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A139IKN0
Sequence length 460
Comment (tr|A0A139IKN0|A0A139IKN0_9PEZI) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=113226 OS=Pseudocercospora musae. GN=AC579_1361 OC=Pseudocercospora.
Sequence
MSAASLPSDYTNEISALNREILKNNPSDILQFCANFFHRRLESQRHEFLLSQRHSSQPGM
AESTFPGSNPFGTTSTAPGQTTGAGGMHSVAEEEEHDFQSPTAHSFPPNVRDLSPSATSN
TLPAGTFGNFGFGSSSGSRSSPPANVTAGAMEQPQSFPNNYNMNRRTSVSAESLAPASAD
DSNWKAPSYPKTKEQLARLKDAVSHNFLFSHLDDEQSAQVLGALQERKVPGENVRVIAQG
DTGDYFYVVESGSFDIYVSTTGKVEPGPEGLGTKVAVSGPGTSFGELALMYNAPRAATVV
SSEPSILWQLDRVTFRRILMDSAFQRRRMYESFLEEVKLFSSLTPYERSKIADALETTKY
PAGSEIIREGDVGDRFYILESGEAIAVKRGREREPLKTYSVGDYFGELALLDDKPRAASV
ISTKDVKVATLGKDGFQRLLGPVESIMRRDDPRRLEESAR
Download sequence
Identical sequences A0A139IKN0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]