SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139WF94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139WF94
Domain Number 1 Region: 111-235
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-34
Family cAMP-binding domain 0.0000124
Further Details:      
 
Domain Number 2 Region: 246-374
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-34
Family cAMP-binding domain 0.0000461
Further Details:      
 
Domain Number 3 Region: 5-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000235
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A139WF94
Sequence length 387
Comment (tr|A0A139WF94|A0A139WF94_TRICA) cAMP-dependent protein kinase type II regulatory subunit-like Protein {ECO:0000313|EMBL:KYB26602.1} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC009259 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MSRSQGRIQVPDDLREVLLEFTISYLLEQPGDVVNYAADYFSRLRETRTTQIVFDQAGTT
ASSPDESTLSREEGSAEKPPVGRFSGRRKSVFAEAYDPEEDEDDGGKVVFPKSDEQRQRL
AEAVRNILLFRALDKEQMQEVLDAMFERVVKEGELVIKQGDDGDNFYVIQNGIFHALVGE
PGGEQKHIHTYENSGSFGELALLYNMPRAATIKAQTDGSLWAMDRQTFRRILLKSAFKKR
KMYETLIESVPMLKTLQPYERMNLADALVPKTYQSGDRIIKQGDAADGMYFVEDGTVIIS
VLDDSGKEVEINRLGKGGYFGELALVTHRPRAASAYAEGDVKLAFLDVEAFERLLGPCMQ
LMKRNITDYEEQMLKIFGSKHNIRDIR
Download sequence
Identical sequences A0A139WF94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]