SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139WHB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139WHB3
Domain Number 1 Region: 17-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000262
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.002
Further Details:      
 
Domain Number 2 Region: 717-795,826-850
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000956
Family Motor proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A139WHB3
Sequence length 2423
Comment (tr|A0A139WHB3|A0A139WHB3_TRICA) Uncharacterized protein {ECO:0000313|EMBL:KYB27299.1} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC014547 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MQMATSIETDTGEMIVKRVSVPVGLEELMEGLTKEVLSKKPKDIYLFASEYFAHLLNLRE
KGSLKATVGKRAQSVTKQIPANNLGKNLKIKSNSVDAVKNLSRQISLRSSSPANKTLTTK
KITLEDKNAEKTKSFLNKRKARKTSKDNSSTSSSSSKQQSVDEKSEKKTPRSRERSVNKN
EEKSTKTPHKRSQEGVKQEKSASKSKVEEKKKEVTKHVPKAVSVESSTEDKSENMKKDVE
IIDNKNPEDNCIGCSMTTDRATDLLVKKTDKEAEVATAISHVNEETEATSNNQTDSNNNK
EIEETVSSLDEVDSSVFSQITGIKKNEVEKKESINKAESQEIEKSELNKQDMIDSSNEES
LNKKKKEAEEKPSDTISSDLVSSVSELQESNETKSLQNKKQKEEIQTQEMNKTTTKALSS
TEEDVTSNLKTENETQMKHLPDKTTNETTNQEKNNSCETETGVKKDETNVLDNKENTNDK
HKASSEKDIKNTKNEADSTSSSKVIYETDKTENLKENVEHEKAKDIKSSSKDVDEINDKE
NEKISVESNKENASENQENKKEIDVNNTTQDKKEKVPEEMSKLTKIPTPLMPANNGNVQE
ISKENKINKQEQKDVRSKDSIKIKNNKSKSLSQESLKTKDEKAARNVKRVKSVDLINKNQ
LEATKSKTFVKTNKTQNNETTKESTVAPENKNVRKKRSTSVEVPKETNLSKTIKQTSFDS
SKLREELKQVDEIGKVTAFKTSYNPYILRQEIKQASQKSEEKNPFETIAKDVTAAIKIQT
AWRGFTARKKTNKLQNDRKSTVDENQKKTEVTQGTDNKSAFEDIAKDVAAAIKIQSMWRG
FLARKKNNKLTQSSKNDKKNKNESKTVKGLEEIEKQKVTHASEKIEAEETNTPEKRSGFE
SIAKDVTAAIKIQSVWRGFLSRKRKKHEEYKAVQAVDINREPEKKDVEQTSKENKIQDKN
NKLENIVKDVAAAIKIQSIWRGFLVRKKTKKSDNDIERNENTPKVMVDKEIINKEQKVDP
SIETSNDKQSNEAKSISGNVDENENRNKSKRKEEHQETKEVEKRDSKIKDDEKSDKVTTS
ALVIAEKNDKLVDSKEKLNNSEGSSTGNANTNIKTTKNFVKSDVESSKNKESVAKTSDEN
NLNQVQIKDVNENVTQEKDNTKEKLDEKIELTDVETSSTTDIKKDEHDKTTIEENKTPQN
KFTDDKNSTAEEGTKVKTTEDVTDVETLKLNDQMKPEKENGHEKPENKKIVRKENKAEQN
KLSNDKNFTDIQEETKVKTTDDVADSQIQKVNEQTKQENEKDQKKPKQENKETTKKEDTT
GQNKLNDVKKSTVIQKETKLETIEKTIENVRNDEIKQGTEDQKQSKQENEKTAKTGQNKV
SDVKKTPSLQEETKSEMKQKTNKNEIDDNNQEKINQIKKEKDNKDDKTSTPQEKEIIDAT
NTQQLSRIETEEKNEIKQNENGIKSDKEKSKTINSLSSNEKDMKEARNTTVNEAKKEKKK
DKQEISKEKQYSVEKEKQNVEKIKPENGKNPKQIDADFKNEETDKKNSADQSDQNKTEQG
VEKSTSKVSLQSTNKSDHNESTTKNNELSTNKLNGTDSESKSNKETNIDKIKEVTADKSH
EIQTTRNEKEVKVGSSVDATNVESKKINDKQENHDKNSNSKQDNLKTKLENTTSNEKAKL
LVEKSDSKNLPDNNQSEKIINKNSTTSESNSQNTNKNLQNPATKEHKEKIDETQGPDKET
KIEPKLQEELLVKKNGMKLDKENSKKIVNEEKTNAMSMADAVLKIQALWRGFRARKQFER
VFGTSVKKEVKNKEALEARKMDKTKAISKIQALWRGYQVRKGIREFDKKLSEQQQPAECD
ELPWHRGLSDDAIFKAACKIQAGVRGYMVRKKGSYNKGTLKSITEEPTDEKLSDEQVLEA
LNQLQEVPEEPPFIKAHKNPEKSVLPANEPNKSNQSPPILNKNELGSNLEKAKVSINATT
GNEIPKNSTTESKEDNKTTENDVEFIAGELNSSTANKLSDSNSAPLIDDSISNSVVNKAE
VDPISREEPGYEDAPTRPVTSNKKEKGEDDKEKNKNDVKTEPESQESSHSGDSIAKKEFA
DETNQNLSEEAGEKLRPGEDELAKTVDINAEIAKMSKTVLEEEIENYNKHLQEMAAKNYE
EFIDTSTLKKEPPVEKDNKITSEFKNNELNNKLNKSSLENEIEKSTKVLQKNVLEKKDMS
TETEIHEENAAASNVKTEKEILRVHIPLRELSDIKEEDTDDKSPIDASKNLDTKTRKSPT
TTISLVHTGELHDAIAVPIPVTPPGGQASPPGLVNTGELHDNVVPLSVQLNEAPPAGAEV
LTSPVSNSITTEAQASNKDASTCEAQPDKTTPSSDSMETEKRNNASIQKKSMEAEAATKI
QAGFRGYQVRKQLKNKVKLRFFN
Download sequence
Identical sequences A0A139WHB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]