SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139WJH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139WJH2
Domain Number 1 Region: 57-153
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 8.95e-33
Family TATA-box binding protein (TBP), C-terminal domain 0.0000342
Further Details:      
 
Domain Number 2 Region: 145-234
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.38e-28
Family TATA-box binding protein (TBP), C-terminal domain 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A139WJH2
Sequence length 236
Comment (tr|A0A139WJH2|A0A139WJH2_TRICA) TBP-related factor-like Protein {ECO:0000313|EMBL:KYB28062.1} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC007228 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MEQKQTDVHLRAMLNSPARFTPAVPTPDWSAGPAVPPSIPGKSNMIVATPGSAAGEPHTN
ITIQNCVTTVDLNTKLDLALINARTRNSEYNPARFHGLIMRLRDPRTTALIFQTGKIVCT
GAKSEQDALLASKKFARIIQKLGFDIKFDNFKIQNLVATCDLRFPIKLESLSLLHGQFCS
YEPELFPGIIYRMIKPHLCLLIFVNGKIVFTGSKSREGIKESLDNIYPILRSFKKN
Download sequence
Identical sequences A0A139WJH2
XP_969256.2.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]