SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139Y187 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139Y187
Domain Number 1 Region: 123-259
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.46e-19
Family Cap-Gly domain 0.00064
Further Details:      
 
Domain Number 2 Region: 25-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000644
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A139Y187
Sequence length 273
Comment (tr|A0A139Y187|A0A139Y187_TOXGO) CAP-Gly domain-containing protein {ECO:0000313|EMBL:KYF44814.1} KW=Complete proteome OX=1074872 OS=Toxoplasma gondii ARI. GN=TGARI_305060 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MSGLSINGDAQARLRLGQDDAAYARLDITHNLHPGRRWMEIVFSLDAPLTSVKDKLYRHT
GSNPSNIKVFLKFTPEDPGRLLLDPTQTLRAVGCVEGCILHVVDESGEAGVIPSGERTEN
MEGKYVMDDETYDKRDGTARKFLARLQKQQPDLFSKKEEKIEEDEESWKKRLDSARTTFA
IGTRCRLSGDRRGAVAYVGPRPSKSLRQIWIGVALDEPLGCTDGRDDPTKKTPASQKVLF
ECNGDNYGEFVEPDQVEVGAFPPIDPFDLLDEI
Download sequence
Identical sequences A0A125YFI7 A0A139Y187 A0A151H597 B6KR27
gb|TGME49_105060 XP_018636126.1.89292 gb|TGVEG_106480 gi|211967964|gb|EEB03160.1| gi|237842005|ref|XP_002370300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]