SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140AYF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140AYF6
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.000000000000602
Family Major surface antigen p30, SAG1 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A140AYF6
Sequence length 71
Comment (tr|A0A140AYF6|A0A140AYF6_9APIC) Surface antigen 2 {ECO:0000313|EMBL:ALJ92633.1} OX=59669 OS=Sarcocystis sp. GN= OC=unclassified Sarcocystis.
Sequence
TGANCQTPETYAKLFSKASNHVWVSPADSTSTSHTWTAPAANQLSGKTVFSVGCTSTGDP
AGICAVDVTVS
Download sequence
Identical sequences A0A140AYF6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]