SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140E126 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140E126
Domain Number 1 Region: 134-192,223-272
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000458
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A140E126
Sequence length 313
Comment (tr|A0A140E126|A0A140E126_MIMIV) Uncharacterized protein {ECO:0000313|EMBL:AMK62001.1} OX=1461100 OS=Samba virus. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MESIFFMIGFENQYQIGLVESSYDDNPDDYLTTNGLYFTNAKYISDYFNQGTTLFEIKLP
IDDNEFKYIRTGDRWRANRLNLVKSYSLFDSETYNKFGLNITDNKYIMDFASSLGKIDFL
DKTRSLKLLYTNKSLDEASINGHISVLNWWKHSGLKLKYTELSIDGASGRGHIDVLNWWL
NLAIYSKIKFKYTQQAINSASKNGKTDSLEWWKRTRLPLIYTTEAIDAASMKRKINSLDW
WLKSGLQIEYTVSSMDHASWNNHTDVLDWWLKSGLELKYSKNCNNWIDRFGRTDILDWWE
KSGLKIKFKHEIY
Download sequence
Identical sequences A0A0G2Y664 A0A0U2UJ88 A0A140E126 A0A165XJ84 A0A1E1EU86 E3VZS8 Q5UNV9 V5L3W4
gi|311978103|ref|YP_003987223.1| YL696_MIMIV YP_003987223.1.55212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]