SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140E146 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140E146
Domain Number 1 Region: 24-186
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000458
Family Pseudo ankyrin repeat 0.03
Further Details:      
 
Weak hits

Sequence:  A0A140E146
Domain Number - Region: 314-424,527-618
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0273
Family Ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A140E146
Sequence length 652
Comment (tr|A0A140E146|A0A140E146_MIMIV) Uncharacterized protein {ECO:0000313|EMBL:AMK62021.1} OX=1461100 OS=Samba virus. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MYFRIRKLDEPDSNDNDFYVVIPVKDIFTWFCSIYSLDKTSIFIHDINNLNPNEYTIQQV
IPGSDISPIKNLNEYLTNDIIITNTLDLNDLETFIYLLTNGANNSEGIKLLVTWCVYYGR
LDVLNYLVDNNILPTENTLRDYLPITISENHDEVYKFIIDHEFHLGYKSNNLSWILTSEY
KYINSLKYTLSNDLKLSDLIFMHHLKVEILQELFSSGYEFDNRLFEKICRTTNITLIKFF
MDIGFDPMNIVIQPNQLCIYLANILLDSGRQFTQNEISQIITFSIVSDDYWDIIAFTERT
GYNWNNINDNFINCIIRRGSLDHLKDILNRTSLNINRFIDNIVITAIFDSRKDLIMYAYE
NNVDIAKYIQSLPYSNDTNFIKWYIELLNSDGNFKSDNNIINFINHGTGTHKFEILKYLL
ENDCYEDPNYIIEHICCPFNIGKNNTDIHEPIVVELLNLCESKQIDVPKLTPIIISNYLL
SNRKISNTLLKFGTTIYSDGIIDNDSDINNILLNIINNQCEEIKDYVYNKPQLWTNKSIM
LATIISENIDLFDFLLELNRDNNLYLEQSFILCANSIKMLKHFVNSINLDITSRVRETYV
YAYSIIKNKSVASYLLLYYGNDMIYDSDNIFENQKNLFVNDFLREIKNLNFV
Download sequence
Identical sequences A0A0G2YE44 A0A0U2SV30 A0A140E146 A0A159ZT33 A0A1E1EUD8 E3W016 Q5UNZ0 V5L2G9
YR734_MIMIV gi|311978143|ref|YP_003987263.1| YP_003987263.1.55212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]