SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140IUC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140IUC2
Domain Number 1 Region: 3-344
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 6.28e-100
Family Pseudo ankyrin repeat 0.00000000000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A140IUC2
Sequence length 368
Comment (tr|A0A140IUC2|A0A140IUC2_LEGPN) Uncharacterized protein {ECO:0000313|EMBL:AMP96286.1} KW=Complete proteome OX=91890 OS=Legionella pneumophila subsp. pascullei. GN=AXF37_12035 OC=Legionellaceae; Legionella.
Sequence
MCNLTIHNIENYEKDPQLRLIPWILWENLFQHFISAYELSLMTLSYKEAMHIFLPGTKNM
EQVRQLLCLYYAHYNRNAKQLWSDTHKKGIKSEVICFVAAITGCSSALDTLCLPLTSDEI
VKVIQAENYQAFRLAAENGHLHVLNRLCELAPTEIMAMIQADNYHAFRLAAENGHLHVLN
HLCELAPTEATAMIQAENYYAFRWAAVGIGHHEVINFLLDCPVMLAYAEIHEFEYGEKYV
NPFIASHLNRLKEMHDAFKQSNPEGIFDLVTKSECLQGFYILRNLIRRNDEALLDDIRFL
LTIPGIKALAPAGTTPGNENELLRLALRLGNQGACALLLSIPSVLALTKANNYYIDETGG
RLDLRAVA
Download sequence
Identical sequences A0A140IUC2
WP_027222525.1.17875 WP_027222525.1.2318 WP_027222525.1.54599 WP_027222525.1.76259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]