SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140LDN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140LDN5
Domain Number 1 Region: 9-57
Classification Level Classification E-value
Superfamily BAS1536-like 0.00000011
Family BAS1536-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A140LDN5
Sequence length 59
Comment (tr|A0A140LDN5|A0A140LDN5_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:KXG78660.1} KW=Complete proteome; Reference proteome OX=520762 OS=Thermotalea metallivorans. GN=AN619_01860 OC=Thermotalea.
Sequence
MNNDYLSKKVIQLVIRLTRERLERLIEKKKGDLLHPDVVSLSQFLDRLIMEYEKLSNNE
Download sequence
Identical sequences A0A140LDN5
WP_068554173.1.79426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]