SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140SJQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140SJQ2
Domain Number 1 Region: 247-325
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000432
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A140SJQ2
Sequence length 417
Comment (tr|A0A140SJQ2|A0A140SJQ2_PSEAI) Uncharacterized protein {ECO:0000313|EMBL:KSH12739.1} KW=Complete proteome OX=287 OS=Pseudomonas aeruginosa. GN=AO964_07385 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MELSPAERQLLLAHRLAVFDGCVVYDAQPPVSAEHVQRLAEGLAGPIPEDLLRLWRTCFG
GRLGYDLEVDYDGHRHPFSFSELFYPDSDGYHDLWGWIEHERELAAEAAAEEGCDWNGKL
AYLPFGGFEYLERLYVCVEPGPEYGAVIAWSHGLPPAWAGRLHQDSVTRLADDVGGLFRL
LSFEQDPFDAENACGVADELLEALDALEAAGEPGKALKGRLEVLLRQRILDWRPALADGS
LAAEPRLRQLALAEAAQDGDIDLLQRLRDAGCDFAETLRGRGGVLEACLARGRLEAARWL
LDQGVAVHQDSLQIGAAHLDAVLAERLLRLGAISDPNTVLLALQYGDADAARIMVRPLLE
ESPARASALRLALASRAERERSDARRVRSGKMGSNRSPDDYLALAERLERFLAELPG
Download sequence
Identical sequences A0A140SJQ2
WP_024947556.1.101269 WP_024947556.1.14615 WP_024947556.1.14815 WP_024947556.1.19718 WP_024947556.1.21096 WP_024947556.1.28078 WP_024947556.1.3781 WP_024947556.1.38587 WP_024947556.1.46633 WP_024947556.1.56864 WP_024947556.1.59376 WP_024947556.1.64212 WP_024947556.1.6627 WP_024947556.1.72727 WP_024947556.1.74268 WP_024947556.1.80910 WP_024947556.1.83374 WP_024947556.1.95018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]