SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140VKG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140VKG8
Domain Number 1 Region: 445-852
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.83e-114
Family PIWI domain 0.0058
Further Details:      
 
Domain Number 2 Region: 107-430
Classification Level Classification E-value
Superfamily PAZ domain 6.75e-78
Family PAZ domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A140VKG8
Sequence length 852
Comment (tr|A0A140VKG8|A0A140VKG8_HUMAN) Testis tissue sperm-binding protein Li 85P {ECO:0000313|EMBL:AEE61305.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_1817581 OC=Catarrhini; Hominidae; Homo.
Sequence
MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGI
SSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGSSGIPVKLVTNLFNLDFPQD
WQLYQYHVTYIPDLASRRLRIALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQ
RGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFYNPSEPMEIPQHKL
SLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGL
IVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLL
KKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDN
IQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILN
AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYV
DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMT
CKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWFSRCILQRTMT
DVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLIEYEVPQLLSSVAESSS
NTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTV
SPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE
PSLELANHLFYL
Download sequence
Identical sequences A0A140VKG8 Q7Z3Z4
ENSP00000299001 NP_689644.2.87134 NP_689644.2.92137 9606.ENSP00000299001 ENSP00000299001 gi|221316711|ref|NP_689644.2| ENSP00000299001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]