SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A141SE84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A141SE84
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.00000000562
Family Chlorophyll a-b binding protein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A141SE84
Sequence length 47
Comment (tr|A0A141SE84|A0A141SE84_GELVA) CAB/ELIP/HLIP superfamily protein {ECO:0000313|EMBL:AMK96602.1} OX=35171 OS=Gelidium vagum (Red alga). GN=Gvag_159 OC=Gelidiales; Gelidiaceae; Gelidium.
Sequence
MYRNQWIWGFSLGAENWNGRLAMISFVIIFIVELSFSVSILRLIGIY
Download sequence
Identical sequences A0A141SE84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]