SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A142D4Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A142D4Y4
Domain Number - Region: 45-128
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0432
Family Fibrinogen coiled-coil and central regions 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A142D4Y4
Sequence length 173
Comment (tr|A0A142D4Y4|A0A142D4Y4_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AMQ22086.1} KW=Complete proteome OX=1813182 OS=Geobacillus sp. JS12. GN=A0V43_15845 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MAHFITANGKVEMEPYSDDFGMTIEFILIKVQRIRAGFNIIQQMMFNSRTKSIEDILGYL
HKVTFEVKENVVYEKLINIFEGKGQSVQFSDWTYIPQNIDTPIYEFERILQFSTQNIEEL
RKITNLFEELGEKRKQSVNDPLMFALNDNLFIERYPDSHLIFLWSEYDDFSDE
Download sequence
Identical sequences A0A142D4Y4 M5QVV6
WP_009361468.1.31030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]