SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A142F0P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A142F0P1
Domain Number - Region: 58-103
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.0471
Family Rabenosyn-5 Rab-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A142F0P1
Sequence length 104
Comment (tr|A0A142F0P1|A0A142F0P1_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AMQ66278.1} KW=Complete proteome OX=1815957 OS=Pseudomonas phage phiMK. GN=phiMK_90 OC=Ounavirinae; unclassified FelixO1likevirus.
Sequence
MTRKQDWPLVSAVGALFISLLVCMAILAFTAMTPEARFDSVRQTYEIRISESERRYELKL
NRLQDQINSASYTQDRQSRLQYEELDSLKRKISELERRIKEKQE
Download sequence
Identical sequences A0A068NXD6 A0A0A1IW80 A0A0N9ERE1 A0A0U3CQ64 A0A125RP90 A0A142F0P1 A0A1J0ME60 A0A291LAZ5 V5JVG7 V5K339
gi|563397308|ref|YP_008857073.1| gi|563448541|ref|YP_008869159.1| gi|663463635|ref|YP_009047071.1| YP_008857073.1.61456 YP_008869159.1.91764 YP_009047071.1.78414 YP_009200020.1.99343 YP_009224774.1.23565 YP_009273838.1.55046 YP_009291158.1.22071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]