SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A142J7Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A142J7Z8
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 9.16e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00037
Further Details:      
 
Domain Number 2 Region: 153-216
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.96e-20
Family Inhibitor of apoptosis (IAP) repeat 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A142J7Z8
Sequence length 216
Comment (tr|A0A142J7Z8|A0A142J7Z8_9CUCU) Inhibitor of apoptosis 2 {ECO:0000313|EMBL:AMR73237.1} OX=1819388 OS=Homoeometamelus sp. 3 SM-2016. GN=IAP2 OC=Cucujiformia; Curculionidae; Baridinae; Homoeometamelus.
Sequence
RHKTLSPQCPFVLNPATSGNVPAVVLPPNLPSSSTFDYKNESVRLASFENWPIPDIVTPE
DLARSGFYSLKNGDNTKCAFCKGVVRAWEPNDIPDVEHKRHFPTCPFVITTINPRLDTSE
SASPMPSQESTFKNMNIINHAVDGNLDELGVQKHNGPKRPDYGTVESRFRSFSSWSPNLI
QTPNLLAQAGFYYEGMGDQVRCFHCDGGLRHWDPDD
Download sequence
Identical sequences A0A142J7Z8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]