SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A143FMJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A143FMJ4
Domain Number - Region: 41-69
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.0157
Family Assembly domain of cartilage oligomeric matrix protein 0.0068
Further Details:      
 
Domain Number - Region: 3-48
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0317
Family ADP-ribosylating toxins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A143FMJ4
Sequence length 70
Comment (tr|A0A143FMJ4|A0A143FMJ4_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AMW63149.1} KW=Complete proteome OX=1805954 OS=Bacillus phage SageFayge. GN=SAGEFAYGE_229 OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae.
Sequence
MSKYTKEEKVAMQDFIQGKISKIDSALAKTEVQLYTEQDIQRMLGELDKVEQAVSDMKWF
LRAEIKEENE
Download sequence
Identical sequences A0A024B0V5 A0A0K2FL35 A0A143FJV2 A0A143FLH6 A0A143FMJ4 A0A1B1PAS4 A0A1I9S5K7 A0A1I9S7D5 A0A222Z1R3 A0A222Z4S5
YP_009036675.1.41166 YP_009212169.1.57637 YP_009278242.1.52610 YP_009281032.1.72104 YP_009285173.1.89825 YP_009291804.1.41515 gi|643218431|ref|YP_009036675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]