SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A145QVW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A145QVW4
Domain Number - Region: 27-61
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0144
Family Mitotic arrest deficient-like 1, Mad1 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A145QVW4
Sequence length 93
Comment (tr|A0A145QVW4|A0A145QVW4_HAEPR) Cell division protein FtsB {ECO:0000256|HAMAP-Rule:MF_00599, ECO:0000256|SAAS:SAAS00959899} KW=Complete proteome OX=738 OS=Haemophilus parasuis. GN=A4U84_09620 OC=Pasteurellaceae; Haemophilus.
Sequence
MRVLVVVLALLLGGFQYAFWFGQNGWNEYQQAKQEVTQLKETNQKLTARNQLIQAEIEDL
KTGINALEERARLDREMVKPDETFYRIVPREQR
Download sequence
Identical sequences A0A145QVW4
WP_010786656.1.53000 WP_010786656.1.54368 WP_010786656.1.56681 WP_010786656.1.58270 WP_010786656.1.65228 WP_010786656.1.76418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]