SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146ACJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146ACJ6
Domain Number 1 Region: 32-126
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 7.85e-23
Family PsbU-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146ACJ6
Sequence length 126
Comment (tr|A0A146ACJ6|A0A146ACJ6_9PROC) PSII-U {ECO:0000256|HAMAP-Rule:MF_00589} OX=1826845 OS=Prochloron sp. LV5. GN=psbU OC=Bacteria; Cyanobacteria; Synechococcales; Prochloraceae; Prochloron.
Sequence
MKRLVSVLAALVLFLGGLGLFTHPSAAADAIYRNETDTKLNTEFGQKLDLNNSDVRDFRD
LRGFYPGLAGKIADNSPFETVEDVLKLPGLSATQLQRLKDNLDKFTVTPPSDVFNEEANR
FNIGVY
Download sequence
Identical sequences A0A143GU28 A0A143GV82 A0A146ACJ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]