SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146FCW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146FCW2
Domain Number 1 Region: 164-279
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.31e-40
Family eIF-2-alpha, C-terminal domain 0.0000479
Further Details:      
 
Domain Number 2 Region: 77-159
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.7e-26
Family eIF2alpha middle domain-like 0.00012
Further Details:      
 
Domain Number 3 Region: 5-83
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000388
Family Cold shock DNA-binding domain-like 0.0000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146FCW2
Sequence length 291
Comment (tr|A0A146FCW2|A0A146FCW2_9EURO) Eukaryotic translation initiation factor 2 alpha subunit {ECO:0000313|EMBL:GAT23697.1} KW=Complete proteome; Reference proteome OX=1069201 OS=Aspergillus luchuensis. GN=RIB2604_01708360 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSLTNCRFYEEKYPEVDSYVMVNVKQIAEMGAYVKLLEYDNIDGMILLSELSRRRIRSIQ
KLIRIGRNEVVIVLRVDKEKGKFEYNKSKAVHSIMRHVAEATQTPLETLYQQIGWPLNRK
YGHSHDAFKISITNPDVWNEVEFPNENVKKELTHYISKRLTPHPTKVRADIEVTCFGYDG
IDAVKEALRTAEAHNTAETQIKVKLVAPPLYVLTSQCLDKAIGIQMLEEAIQRIEAKIKE
SGGGCIVKMAPKAVTEHDDAALQELMEKRERENMEVSGDESMSESDEGVPE
Download sequence
Identical sequences A0A146FCW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]