SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146FLN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A146FLN5
Domain Number - Region: 281-385
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.017
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146FLN5
Sequence length 691
Comment (tr|A0A146FLN5|A0A146FLN5_9EURO) Pentatricopeptide repeat protein {ECO:0000313|EMBL:GAT26598.1} KW=Complete proteome; Reference proteome OX=1069201 OS=Aspergillus luchuensis. GN=RIB2604_02102780 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPRTTLVLDGLWYCLCPSFNAATFNRATPSFTAGRRIPKHDRITALRSSISDPPRRCLTN
FTPRPTDATIEIVEDNRHTFTNSSSSSDQQPFDPDDAGAQDNVRPGDLLSPMERLTKPPP
GVPKYFKHLPSQRLENRLQERVARYPRVLSATQILRVLIRDRHVRPEMRHYRGLILANSD
PERGSPQAVRALLKEMEENGIPADSGTLHAALQVLAVHPDYLLRQEIVRTLRDRWLPLSP
AGWHFVVAGLIREHQFELALDHVEQMERKGMVVENWLHSLLIYYLCDFGEFDEVVRLMRS
RTSQGLDMSSELWLYVLEVASAALHYDTTRYIWRQMVELRYLHPGYPLCSNVLSVAARAG
DTELAASVIRFLVEVNVQPQLDDYEKMVEAHAVSGSLYSAFEVLCKMHMADIAVEHRSTR
AILTHLLQSRTTPRGAWTMLKQLKATKLTVPLGCAKVVLEMCEHEALDNPSVVYEGIAFY
KELYALCPGKADVTVYNILLGMCRRARNTEAGMFIAKEMASLGVIPDQGTFEHLIVMCLE
AGNFESGYMYLQDLLGRGIRPGEETRAAIRELCSPSEDQFASRLRHHPQIQDGSVGCLVD
EISNTHEPPDSTEQEEGNGKEESFHRSGQTPTQAEMERQALHKLRRAAAKERRKRKRRLA
AIAQGQEEEGWLDYEPGGLIPEDQLNAKSND
Download sequence
Identical sequences A0A146FLN5 G7X5C7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]