SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146FQG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146FQG7
Domain Number 1 Region: 71-242
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.06e-21
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00049
Further Details:      
 
Domain Number 2 Region: 384-396,439-551
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000235
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146FQG7
Sequence length 634
Comment (tr|A0A146FQG7|A0A146FQG7_9EURO) Phosphopentothenoylcysteine decarboxylase {ECO:0000313|EMBL:GAT27965.1} KW=Complete proteome; Reference proteome OX=1069201 OS=Aspergillus luchuensis. GN=RIB2604_02500400 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MAVGFGASFPSTSTGVATVVSKGVWSSEMEITTEMGGKLTENTTTTPMQIDNQIQEAPGS
SPPRRKRLLLSTESAFVDNILPSLVQNPDIEIRLITDEPSALLSGASKVPHYMDTVDSQT
FEKKTGARKWLKAKAAELCEWADMLLVAPIDAGALGSMLYGLTNTLTLALLRGWISSKPV
VLIPGMTVSEWHHPLSKRQLREVAEFWPWISVVSPVLWESVSPEELVQLPWEGLKELHEV
LERTLGLSSSQVSTKPGQLTDSTYPTGISEQMPGDAASTISRHLLHRSNKTENGPRSLPM
ELWLNIFEDQLHDWEIAKAVGIPTNLPVPKEWQNHLLKMSTPASLEYTILRGSFAAIKKR
IDSLPRWKPLSDLVCHLIFKFSRTDILSYLTENHLDLLWTTSRLTNLPYRASAIYGNPNI
LTWWRDAPALPNKEYIADAMDGASRAGFVNVLEWWRTSGLELRYTERALEAASAEGRVAV
LAWWKAASANAPPSNPIPLKVGKSVLLAAQSGRTASLAWWDASGIPYTHGESVARIASTH
GHVHVLDFWYRLKGAKMIFDSQVLVGPTKNGHDNVLEWWRRSGLRVEFKTCDIEEALEDA
DPVSGAEERVRKWWARNGLNLGVGTSEWMKTKVL
Download sequence
Identical sequences A0A146FQG7 G7XG45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]