SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146K8Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146K8Y8
Domain Number 1 Region: 114-125,176-268
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000458
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146K8Y8
Sequence length 384
Comment (tr|A0A146K8Y8|A0A146K8Y8_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:JAP92235.1} OX=1076344 OS=Trepomonas sp. PC1. GN=TPC1_15896 OC=Eukaryota; Diplomonadida; Hexamitidae; Hexamitinae; Trepomonas.
Sequence
IQINNLFSEFSEYLFDSFQKMQKIDLINERLKNIERNVRSIDETTKIKKMATNDTIDDLI
RTNQSLRENAQNIITNLNLQLSRQQEYMKKIQEEGSQIIKQTQCIELPQLPSPELIKSRF
HEQVTEINTVHWFDAIICGNADYVSQQLTKYSKSYDTREKPSDDEQDKIIRKGWSGIHYA
AAHKDLQIFKILFNEEYDLLTAQSHQLFLENQNRSISIPSGSSIIHIILASNAIDLLDFV
LQMFQKDEKFQNLAGVENDKKESALLLAPYLNTDAAWQWARCPVAIMSEIQQKSSIQMNF
LMMTAKLGRVRYAELIKDFIDEQKFLTVKIDGLQTAILQLFKDSYLAAANWEQLALGKVD
YEKYGVNQAEKKKCWQILTSVYKG
Download sequence
Identical sequences A0A146K8Y8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]