SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146MP65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146MP65
Domain Number 1 Region: 90-177
Classification Level Classification E-value
Superfamily BAG domain 1.65e-30
Family BAG domain 0.000052
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000337
Family Ubiquitin-related 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146MP65
Sequence length 278
Comment (tr|A0A146MP65|A0A146MP65_FUNHE) BCL2-associated athanogene {ECO:0000313|EMBL:JAQ21359.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
DALSEATGVPPASQKLIFKGKSLKDMEVSLSSCGVKKGCKLMMIGKRNSPEEEAELKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKRNSPEEEAELKKLKEIEKSVEQTAKKLES
VDGELTGLKNGFLAKDLQAEALSNLDHRVKIAAEQFMKILEQIDALNVPENFTDCRXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXCLERAGKFYRLQNEEKESCKNSPGFPRPVRQDRGL
HIRPPVKDPVQKPGSGRVVDSPPLGALSCSVSNAKVYR
Download sequence
Identical sequences A0A146MP65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]