SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146P584 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146P584
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.22e-28
Family Txnl5-like 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146P584
Sequence length 123
Comment (tr|A0A146P584|A0A146P584_FUNHE) Thioredoxin domain-containing protein 17 {ECO:0000313|EMBL:JAQ32769.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MARYEEVNVHGYDEFNKAVSERKGKDIFAYFSGDKDAEGKSWCPDCVKAEPVVRGELTHL
PEGSVFIYCQVGDRPYWKDPNNDFKKTLKLTGVPTLLRYGTPQKLVEDECFKPELVKMMF
TED
Download sequence
Identical sequences A0A146P584
XP_012730006.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]