SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146WZY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146WZY9
Domain Number 1 Region: 307-444
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-34
Family cAMP-binding domain 0.00000327
Further Details:      
 
Domain Number 2 Region: 172-303
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-32
Family cAMP-binding domain 0.00000143
Further Details:      
 
Domain Number 3 Region: 3-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146WZY9
Sequence length 462
Comment (tr|A0A146WZY9|A0A146WZY9_FUNHE) cAMP-dependent protein kinase type II-alpha regulatory subunit {ECO:0000313|EMBL:JAR34859.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MSTVEIPAGLKELLQGYTLEVLRRRPPNLVEFAVQHFTRILENQKNEQRAGKQSSSDTSG
GSSKPAEKEVAIETVANKSNENDEEEEEVKEAPKSRTGRSRRVASSSSKPAEKEVAIETV
VNKSNENDEEEEEVVKEAPKSRTGRSRRVAVCAEAYDPDNDADDDTQPQVVHPKTQEQRQ
RLQDACKDILLFKTLEKEQFSEVLDAMFEVLVKPQDHIIDQGDDGDNFYVIDKGVYDIFV
AKDGVSVCVGKYNNKGSFGELALMYNTPRAATIVATEEGTLWGLDRATFHRLIVKNNAKK
RRMYEAFIECVPLLNCLELSERMKIVDVLGVRAFKDGDRIIAQGDKADCFYIVESGEVKI
LIRSKTKAGRQDNAEVEVARCSRGQYFGELALVTNKPRAASVYAVGETKCLVIDIQAFER
LLGPCMDIMKRNISQYEDQLVALFGCSDDLKHQDSVSEPACE
Download sequence
Identical sequences A0A146WZY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]