SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146ZRB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146ZRB4
Domain Number 1 Region: 26-123
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-24
Family SH2 domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 143-190
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000105
Family SOCS box-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146ZRB4
Sequence length 191
Comment (tr|A0A146ZRB4|A0A146ZRB4_FUNHE) Suppressor of cytokine signaling 2 {ECO:0000313|EMBL:JAR68844.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MTCQSSDAIEDDRGAGAGTEESDQSRVASAMKELRKTGWYWGSLTANEAKEILQDSSEGT
FLLRDSSQRDYLFTISAMTSAGPTNLRIEFRHGKFKLDSVVLVKPKLKQFDSVVHLVEHY
VQLSRTSRAAPAGGAGPNGTVQLLLTRPVYRSTPSLQHLCRVAINGSARRVQDLPLPPRL
KDYLTDYAYNV
Download sequence
Identical sequences A0A146ZRB4
XP_012732213.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]