SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146ZT94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146ZT94
Domain Number 1 Region: 281-405
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.9e-33
Family cAMP-binding domain 0.000000529
Further Details:      
 
Domain Number 2 Region: 175-271
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-29
Family cAMP-binding domain 0.00000283
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.96e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00011
Further Details:      
 
Domain Number 4 Region: 118-171
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000314
Family cAMP-binding domain 0.0000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146ZT94
Sequence length 414
Comment (tr|A0A146ZT94|A0A146ZT94_FUNHE) cAMP-dependent protein kinase type I-beta regulatory subunit {ECO:0000313|EMBL:JAR69175.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MASGSTSSEEERSLRECEQYVQKHNIQQLLKDCIVQLCTSRPDRPMAFLREYFERLEKEE
AKQIQNQQKASSSRSDSRDEEVSPPMNPVVKGRRRRGAFSAEVYTEEDAASYVRKVIPKD
YKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVTYIAGETVIQQGDEGGXXXDDNERS
DIFDAMFPVTYIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWVTSIGEGGSFGELALIY
GTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLRKVSILESLDKWERLTV
ADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEI
ALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A146ZT94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]