SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A147ADX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A147ADX6
Domain Number 1 Region: 33-205
Classification Level Classification E-value
Superfamily MIR domain 2.75e-56
Family MIR domain 0.0000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A147ADX6
Sequence length 220
Comment (tr|A0A147ADX6|A0A147ADX6_FUNHE) Stromal cell-derived factor 2 1-like protein {ECO:0000313|EMBL:JAR76587.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MERLCLFPGLLQWLLLPLFLLLLSGCEGRESELDYVTCGSLVKLLNTRHNVRLHSHDVKY
GSGSGQQSVTGVESADDANSYWQIRGKPAHPCQRGSAIKCGQAIRITHMKTSRNLHTHHF
SSPLSNNQEVSAFGENGEGDDLDVWTVQCEGVYWERDEAVRFKHTGTEVFLSVTGEQYGH
PIRGQREVHGMSSPNQHNWWRTTEGVFIQPSQEPLRHDEL
Download sequence
Identical sequences A0A147ADX6
XP_012716156.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]