SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A147F1K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A147F1K7
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 3.66e-18
Family PG0164-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A147F1K7
Sequence length 98
Comment (tr|A0A147F1K7|A0A147F1K7_MICTE) Uncharacterized protein {ECO:0000313|EMBL:KTR96738.1} KW=Complete proteome OX=2033 OS=testaceum). GN=NS220_00700 OC=Microbacterium.
Sequence
MIVRFEGEVYRWEARTDSDWYFVALPADLSDEIREIQTYRRGFGGVRVEATIGGSTWRTS
IFPQTGGFFVLPLKRAVREAEGIAPDGVVLVDLLVLDA
Download sequence
Identical sequences A0A147F1K7
WP_058622199.1.30153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]