SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A147JVC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A147JVC9
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.92e-21
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00012
Further Details:      
 
Domain Number 2 Region: 80-179
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.86e-21
Family Cold shock DNA-binding domain-like 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A147JVC9
Sequence length 185
Comment (tr|A0A147JVC9|A0A147JVC9_9EURY) DNA-directed RNA polymerase subunit E {ECO:0000313|EMBL:KUO40423.1} KW=Complete proteome; Reference proteome OX=1775755 OS=Hadesarchaea archaeon DG-33-1. GN=AVW06_00125 OC=Archaea; Euryarchaeota; Hadesarchaea.
Sequence
MYKILTVRDTVRVPPSRFDEPLEEVVLDVLRKSYEGLTDKDVGAILAITEVKEIGTGRII
MGDGASYHNTTFEALVYKPELNEVVLGEVVEIVEFGGFVRLGPVDGLAHVSQVMDDFVGH
DRKKGALYGKESKRSLKEGDKVRARIVTVSMKKGARAGKIGLTMRQPSLGKLEWIEEERK
KRGKG
Download sequence
Identical sequences A0A147JVC9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]