SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A149QCW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A149QCW2
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily VC0467-like 6.8e-63
Family VC0467-like 0.00000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A149QCW2
Sequence length 188
Comment (tr|A0A149QCW2|A0A149QCW2_9GAMM) UPF0301 protein AB839_13680 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome OX=1609637 OS=Stenotrophomonas sp. DDT-1. GN=AB839_13680 OC=Xanthomonadaceae; Stenotrophomonas.
Sequence
MPVMPTSLADHLLVALPSLLDATFARSVALICQHDENGAMGVLVNQPSEYTLGEVLAQMD
ITTGDGELQARMVLNGGPVHPERGFVIHDDARAWDSSLTVGDGLYLTTSRDILEAMARGE
GPANAVVTLGCAGWGAGQLESELSENSWLTVPADAELVFQLPLEQRWQGAASRIGVDLFR
LTDYSGHV
Download sequence
Identical sequences A0A0U5D8X6 A0A149QCW2
WP_058979385.1.22719 WP_058979385.1.71426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]