SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150DEY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150DEY1
Domain Number 1 Region: 19-69
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000000000000327
Family BAS1536-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A150DEY1
Sequence length 72
Comment (tr|A0A150DEY1|A0A150DEY1_BACCE) Transcriptional regulator {ECO:0000313|EMBL:KXY59415.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=AT261_07845 OC=Bacillus cereus group.
Sequence
MYYNFTSNIMGKGSFSIEMEMGQLQNKIESKKKELIQLVARHGLDHDKVLLFSRDLDILI
NKFMNGKDKVHK
Download sequence
Identical sequences A0A150DEY1 A0A1H6BG57 A0A2B8MHH9
WP_061666856.1.101720 WP_061666856.1.4447 WP_061666856.1.61820 WP_061666856.1.73638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]