SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150EC71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A150EC71
Domain Number - Region: 362-379,437-466
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.011
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150EC71
Sequence length 488
Comment (tr|A0A150EC71|A0A150EC71_BACCE) UPF0061 protein AT272_19100 {ECO:0000256|HAMAP-Rule:MF_00692} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=AT272_19100 OC=Bacillus cereus group.
Sequence
MTKNNEAGWNLDNSYATLPHSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKETEI
AIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEDPENRYTALLQEVIKKQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDHYDQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDEEEALKIAQDEISKFSVQYENLWFLGMKKKLGLFSNEEQDHSLIE
QLLKMMEKYKADYTNTFRSLTLNTLENTPLFDSSEFKEWYKLWQSRLERQDESKENAYEM
MKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALANPYAYATDQEEYCVTPAPTNR
PYRTFCGT
Download sequence
Identical sequences A0A150EC71 A0A1J9Z5C3 Q733Y5
367724 222523.BCE_3522 WP_000164894.1.24759 WP_000164894.1.39001 WP_000164894.1.45089 WP_000164894.1.49802 WP_000164894.1.79043 WP_000164894.1.92347 gi|42782573|ref|NP_979820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]