SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150FYG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150FYG7
Domain Number 1 Region: 318-494
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000758
Family Ankyrin repeat 0.0074
Further Details:      
 
Domain Number 2 Region: 159-242
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000235
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150FYG7
Sequence length 611
Comment (tr|A0A150FYG7|A0A150FYG7_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ42090.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_208g402 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MDIVDSSSLSDDFGRIIMPPPEVADDDTNDLLKRADQLASVEPDAAAHADDADWSQLPAE
LLERIWDLLISMPNVLACTLRQLDKARAALFSGPEHTRVRLSRFVPPYAFSARWAASGAL
RSFTLARRLQLLRLTAASGCVPNMEAALAAAACMPTSGVLGAAAAAGQLHMCEWLLQRGC
PASGALEAAAGAGQLAACRWLIARRAVPLDPKAAKRAVDAAAAGGHWRLAEALAETDPHH
FPRQLLAAQPRLLSLVAHGCDLATLQALHGEWHHHRWGLDAILAAAAASPTTDWRAKVEW
LEGVCGYRQSVEACAAAAALPDARERLAWLEGRGYTLDDYRFRACEAPRQAVTRGDLDLL
QYLWEELGLYHGRDGSWRDSRRSGHDAAESAARGGHVHVLAWMAERGLGGALLGSAVLDA
AAAAGSLEAMAWLRGRGCHWATRAWVAAAGGGAEAALEWLAEHGCPFPDNGSPFVTACHN
GDTATVNALARLGCPWGPPGQLFKKVLDKRIGGGAAAAAGGGGAGGPGSATSTTSTMTSS
FFPASWLGAVRALLAAGCPLRPGGAAEAEARKLRDPTERRELLADLAELRRRRVQQDKGR
QEEGVQGGQRG
Download sequence
Identical sequences A0A150FYG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]