SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150FYL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150FYL6
Domain Number 1 Region: 61-168,203-222,261-298
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000365
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 2 Region: 338-419
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000262
Family Pseudo ankyrin repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A150FYL6
Sequence length 515
Comment (tr|A0A150FYL6|A0A150FYL6_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ42677.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_125g510 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MDRNEVATSFRLVNKAAAAQFSGPEYATVRLWQPVPPHAFAAHWLAPDATWGLTLKQRRK
LLWLTAFSGVVTNLEVAEHAAGCPPTYEVFEAAVIGGHMGTCQWLYARGCPTSCSAGAGS
GLLCAAAYGGHRHVCEWLLSLGLAWSSWGDAGAAHGGHVGLMEWLQEERRTRRGVRDGIF
PWFELMHSVTSRCDLAALKRLWPGLDDDRLDLAKCMLLHIAAGSRTSDWAAKVEWLEARG
CLRDASCAASAAERPDAVSRLTWLRARGYPADVKAVMRAANAGNMPALRYLLSEAGVRQS
DPAHPPSSSVTFNAEHLQPLEALHAAGWLLDAGRLAQLAAEGGRLHVLAWLVETFQGAEA
GSVRLNADLFRKAARSGSVELLAWLRERGCAWDEGIWEMAAGAGCEEALEWLAERGCPMP
ADGGPYVAACANRDLLAVRCLRRLGMPWGPAAAASEAVRSAPAAMADWLREAGCLVDDVE
VTGAGIVAGRCIVRHGASELTTSATGTGGIDEGSA
Download sequence
Identical sequences A0A150FYL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]