SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150FYX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150FYX4
Domain Number 1 Region: 327-441
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000824
Family Pseudo ankyrin repeat 0.027
Further Details:      
 
Domain Number 2 Region: 413-442,517-578
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000222
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A150FYX4
Sequence length 639
Comment (tr|A0A150FYX4|A0A150FYX4_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ42813.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_116g345 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MTSSARVFPQLPPELTERIVCKLDRNEVAASFRQVNKAAAAQFSGPEHTIIRLSQPVPPH
AFAAHWQAPGAMRGLTLSQRRQLICATATTGSVANLEVAVQAAGCLPSYRALQASASAGQ
LDTCRWLIEHGCLTHPHDRDSYIDGPAVRWADDIAFVAASGGHKHVCDYLKALQDKGWVM
GCVIGAARGGHIALMEQMNQQRRPRRRHARSQGVSVSANEAHFTLWAVAHGCDLATLQHF
WVSMRPRRGPVDSVHTIMEAAAGSPTEDWAAKVEWLLGELGGDPSNGVWLCTATEACSRP
DALARLKWLRERGFPIDSSATVQLACTGNTQALQYVLAELGPAGDGRERVRAIDLEDAAR
CGHLAALQALHGAGWRLSNRCLVLAAAAGGQLQVLAWLMETLDGPVVQLGTDLFAAAARS
GNVALLAWLRERGPAPPAWRNDAYEAAAESGCEEMMEALAQAEPAKPNLPSRTCQAEPAK
PGVWGVCLRLLSFALGFSAQAVGQPAGVIGPTGHQTTGRAYVAACVNGDLAMARCLRRLG
VPWGHGQAGSTKVFTEAAAKGAPLRMLRWLLEEGCPVDKAQAREAVESWAGRASNRAYRT
VEAEVSQVLGLLGPAPAGPRAKKQRTVRKGRKSKRITTL
Download sequence
Identical sequences A0A150FYX4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]