SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150FZN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150FZN3
Domain Number 1 Region: 110-205,304-378
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000121
Family Ankyrin repeat 0.0065
Further Details:      
 
Domain Number 2 Region: 289-289
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000432
Family Pseudo ankyrin repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A150FZN3
Sequence length 565
Comment (tr|A0A150FZN3|A0A150FZN3_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ43076.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_104g82 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MEASEPEHHCAYRVFSQLPPELTERIASNLDGNEVAGTFRLVNKAAAAQFCCPEHTAIRL
SQPVPPHAFAARWLAPGATRGLTLKQRRRLLSLTAGSGVVANLEVAVQAAGCTLSYEAIH
AAASAGQLASCKWLHKRKCPTSFREPSASGLLAAAAGGGHRHVCEWLLGLPLVWSSDGAA
EAAHGGHVGLMEWLLERRAAKDIRVPSHSSPRLERLQLARGAAHSCDLPTLQRLLRGWAP
PAGRDEMEEALAAAAGSPTPDWAAKVEWLEAQGCPRSARAAREAVRSGHREGGDHQGGAA
ARLAWLRGRGYPIDGVACVAACRAGDLAALRYLLAETPALGPPGMDVVSGIAASAAASGG
HLAALRALHAAGCELNVRYAARSAAGDGRLHVLAWLVETFGEQEVGLDEWLFGEATQSGS
VELLAWLRGRGCGWGVGAFSRASSVAVLEWLAERGCPMPDTGYPYAIAGNLGDLASLRCL
RRLGIPWGPPGRVLVDALSGRGAPVPVLRWLRQAGCPVGDRNALRSALWVRQERKAAARQ
AAAEAGAEAGAEAGAEAGARAARAP
Download sequence
Identical sequences A0A150FZN3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]