SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150G5U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150G5U9
Domain Number 1 Region: 296-374
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000314
Family Pseudo ankyrin repeat 0.0096
Further Details:      
 
Domain Number 2 Region: 350-434
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000615
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A150G5U9
Sequence length 515
Comment (tr|A0A150G5U9|A0A150G5U9_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ45259.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_56g355 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MLRSPEFTVVRLSEPVPHHAFAWRWGRPGAMRDLTRARRRELLCLTAASGATANLQVAAR
AVGFKPTREVAHAAGKAGQLGSILMLEELGCDVHDAVKGAAAGGHLVLCGELLQQRAGDS
SPYDAFDCACEAADGGHVDVVDFMVRRLQIVGLAGSGLESSLMAHIAGGCELAALQRYYR
ELVPEVFNNARAFDWEKERILGCAASSPTPDWRAKVEWLEAQGFPRVSGVFYGVVERPDA
MERLVWLEQRGYTCDPVYTLGAGIGGNADVVLLLAERQAEDDDDEDADPYTDVASEAAAC
GHLHVLQVLHAAELVFSPGYVIRAAASRGHLHMVAWLFETLGVQLDEELFEGAAGSGSVQ
LMAWLRERGCPWDSRAVTAAARSGCVAALEWLAERGCPMPDDGLPYFEAGKSADLATVEC
LRRLGCPWGPPGLVLGACISGGLPGCPYNNCASGVLPVLSWLLAAGCPVDWPGAVAAAEA
ECSRVSDGAGHSPSELRDRRRVLAWLHFQASRLQV
Download sequence
Identical sequences A0A150G5U9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]