SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150G626 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150G626
Domain Number 1 Region: 342-425
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000314
Family Pseudo ankyrin repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150G626
Sequence length 558
Comment (tr|A0A150G626|A0A150G626_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ45297.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_56g393 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MDFAVPNPDAMLSSGTSLPEILIPGILDCLLPRNGLACSLRVVNKATAAILGTPEFMTVR
LSEPVPHHAFAWRWGRPGAMRDMTRAQRRELLCLTAASGATDNLALAARAVACPLTAEVG
YAAGKAGQLGSCAMLAELGYDMGRAVEGAAAGGHLALCEELLSRWAGVRHDLFICAVAAA
KAGHVHVAEWMMRRDEGMRPSSQAVWKIGEGVAERCDLATLQRFLAKWTRQRRAAQGWVE
QSQLCVLAAAAGSHTPDWRAKVEWLESQGFPQTWRAFAAAAKRPDALERFAWLAQRGYPR
PDGGKLVVSLRGVARGGNAAAVLCLAEDWPASPDFTDVAGAAAVSGHLHVLQALHSAGRR
FDAHGASSGAARNGHLHVLAWLVEEALGLDAVPLHEELFEAAAGSGRVELLAWLRERGCP
WGVRTFTADVESGCEAALEWLVERGYPMPEDGSPYEVAAQAVDVATLEGLRRLGCPWGPA
RRLLDSGVAGGVPVMSWLVASGCPLHWRGGLVQAIEAEAHRRVQEASEGMDWGRWARRRE
ESVRVLAWLRAEAAARRP
Download sequence
Identical sequences A0A150G626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]