SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150G772 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150G772
Domain Number 1 Region: 6-194
Classification Level Classification E-value
Superfamily eIF4e-like 3.01e-65
Family Translation initiation factor eIF4e 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A150G772
Sequence length 201
Comment (tr|A0A150G772|A0A150G772_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ45190.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_57g480 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MDNREEGEVESVEPDFNKKHPLENKWTLWFDNPNQKQTQKQYGQSLRSVYTFDTVEDFWC
LYNNIRTPSQVNVGATYYLFKEGIEPKWEDARNLKGGCWTAPVPAKGDGKKTLDAWWLNA
VLACIGEQFTDGDEVNGIAVVIRARGDRIELWSRTASNEAAQTMVGKQLKQFLDIPESNK
IGFSVFEEKITQNKAKDRYMV
Download sequence
Identical sequences A0A150G772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]