SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150GC16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150GC16
Domain Number 1 Region: 184-473
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.64e-125
Family Enolase 0.00000000567
Further Details:      
 
Domain Number 2 Region: 47-180
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.02e-58
Family Enolase N-terminal domain-like 0.00000236
Further Details:      
 
Domain Number 3 Region: 3-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150GC16
Sequence length 477
Comment (tr|A0A150GC16|A0A150GC16_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ47396.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_35g834 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MSVQEYIEKHGLEKRVEEVLNLCVKEKPEEPLSFMAKALQQLSPPEIVKVVGRQIIDSRG
NPTVEADVYTRKGCFRAAVPSGASTGVHEAVELRDGDKSKYLGKGVTKAVENINAIIAPA
LKGLDPTKQTEIDAKMKELDGTDNKGKLGANAILAVSIAVCKAGAAEKGVPLYKHIADLA
GNSKLILPVPSFNIINGGSHAGNALAMQEFMILPVGASSFAEAMRMGCEVYHALKGLIKA
KYGQDACNVGDEGGFAPNIGSNEEGLNLVNEAIEKAGFTGKVKIGMDVASSEFYTEDGMY
DLDFKNQPNDGSQKKTKEQMLELYKEFCHKYPVVTIEDPFEQDDWEPATKLTAEGICQVV
GDDILVTNPTRVKKAIDGKAVNALLLKVNQIGTVTESIEAVRISKEAGWGVMTSHRSGET
EDSFIADLAVGLATGQIKTGAPCRSERNAKYNQLLRIEEELGEAAQYAGESWRHIGW
Download sequence
Identical sequences A0A150GC16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]