SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150GED9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150GED9
Domain Number 1 Region: 381-466
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000837
Family Pseudo ankyrin repeat 0.025
Further Details:      
 
Domain Number 2 Region: 441-522
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000068
Family Pseudo ankyrin repeat 0.037
Further Details:      
 
Domain Number 3 Region: 120-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000269
Family Ankyrin repeat 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A150GED9
Sequence length 609
Comment (tr|A0A150GED9|A0A150GED9_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ47945.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_31g307 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MAHVSTSTWKPWRDRRISDEATAYARSSALTSQEHDSSLGLFRDSASRVWIPDLVERIAR
HLPPNELPCTLRLVDKATAALFSGPHHTTVRLSQPVPHHAFARAWGQPGATQPLTLAQRQ
QLLCLTAATGVTPNLELLLSCPDCLPTTTSSTPIEAAASAGQLAACLRLRQAGCPWGDAL
SAAAAAGHAEVCTGLLAAGCPWSWTAVCAAASAGQTAAAAALPAAQARGKGRPPRRDADG
GLATASEYVVAAARGCDLTTLQSSYQQWSARMGLQQAVGALSTTAFVRFTRELLPAAAGG
PAADWQAKVEWLEAQGCSREAYVSEAAAAAGADGLGRVQWLRGRGYPWGRRVAAAFARTG
DVAALRYLLAEGVQLTEEAATEAAAGGHLAALQALHAAGCPVSPLDVACAAAEGGHLTAV
AWAVEAFGAAATLSVRVSSSAAKSGNPELLAWLRERGCNWGPETFVGAAEAGDGKALAWL
AERGCPMPADGQAFVAAARNGDLQTLACLRRLGCPWGPAGEAFGRCLDARCPLAALRWLA
AEGCPVDWRAAAERARARWDRRAGEGAQVLAWLEEQRRQQLCESPVPEAAPTARHRRTQW
WLGALVCGA
Download sequence
Identical sequences A0A150GED9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]