SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150GG75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150GG75
Domain Number 1 Region: 431-508
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000641
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A150GG75
Sequence length 619
Comment (tr|A0A150GG75|A0A150GG75_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ48841.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_25g426 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MAAPPDVVRAAPNIWLPGLVERFASCLGPNFVACTLRQVNKATAEQFRGRPEYPSTVRLS
QPVPQHAFAARWAPRGAMRDLTLTQRQRLLRLTAASGVVANLEVALGAVGVIPDSQLEEE
ILGAAAAGGLAAAVRCILGFGYGDTHVIGKTLCTAAGAGHQAVCEVLLADDRAPGVTADD
VAAALRGGHSGLADWLLQQRWEGPISPADSLEPLGEEGCSELLRAATEGCDLPTLQSIHQ
RCSEVVNGDDGMVRIAASSRTTDWRAKVEWWELQLPPDWLYDDPGVCTAAARCPYAETRL
AWLLGRGYSVERAATDAALGAGNAAALELLLRRGLLPEPRSVTEAARGGRLEALMKLAEY
GCPVDAAEVALAALRQGPLSVLAWAVEELGASVQALATAATAWNVRNLDDPEVLRWLWRR
GCPLNGSRVALLAARCGQLDALEWAAQELGASMRSDELMDAAGASGSIEVMAWLRERGCP
WGPDTFAGAAGSGCEAALEWLAERGCPMVKSNPRRTAYRVGGRVYNGRAMPLMPDFEAAS
NNDLAALRCLARLGCPWGDLPGITTVFNSCLAHPCRPMPVLRLLVELGCPAVYYGRAPIP
ADVRKWLEAVKAEAEGVAQ
Download sequence
Identical sequences A0A150GG75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]