SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150GHK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150GHK5
Domain Number 1 Region: 417-499
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000288
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A150GHK5
Sequence length 561
Comment (tr|A0A150GHK5|A0A150GHK5_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ48840.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_25g425 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MADSCDADKAPPNVWLPELVERFASCLDPVFVAWTLRLVDKATAEQFRGRPEYPSVVRLS
QPVPPQTFAARWAPPGAMRDLTLEQRQKLLRLTAVSGVVANLEVALGAVDFIPNRRLWAE
ILEATAAAGQEAAVRCLVGFGYGEPNRKTLCVVAGAGHQAVCEVLLGRARSFGTIHGIEA
YVAAALRGGQPELADWLLQRWWEEPIGPADSLEPLGKETCLELLHAATEGCDLPTLQSIH
QRCSEVVHGDDDMVRIAAGSRTTDWQAKVEWWESQLPPDWLYDDPGVCTAAASCPDADIR
LAWLLGRGYPTEKYALRAVVGSGNTAALELLFRMAAREGNVPLLVEAVEQLGTSDQDPLL
SEPAEDVCDLEVLRWLRQRGCQLNGTEVARSAVRRGQLAVLAWAAEELGASVQSADLMDA
AAASGSVEVMAWLRERGCPWGLDTFAEAADSGCVAAMEWLAERGCPFQDGWAYKKAACNR
DLAALRCLARLGCPWGTASGARAVFSSCLDCRCRPLPVLRLLVELGCPVDWEACRDQKFV
YGETREWLLAQAAAAAQGVAL
Download sequence
Identical sequences A0A150GHK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]